GPR152 Polyclonal antibody

• 

  IHC staining of mouse spleen using 24391-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 24391-1-AP (GPR152 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 24391-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 24391-1-AP (GPR152 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 24391-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24391-1-AP (GPR152 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GPR152 Polyclonal Antibody for IHC, ELISA

Cat No. 24391-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

G protein coupled receptor 152, PGR5

---

Tested Applications

• Positive IHC detected in: mouse spleen tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24391-1-AP targets GPR152 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18420

  Product name: Recombinant human GPR152 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 303-470 aa of BC122869

  Sequence: RTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQPQSDPTAQPQLNLMAQPQSDSVAQPQADTNVQTPAPAASSVPSPCDEASPTPSSHPTPGALEDPATPPASEGESPSSTPPEAAPGAGPT

• Full Name: G protein-coupled receptor 152
• Calculated Molecular Weight: 470 aa, 51 kDa
• GenBank Accession Number: BC122869
• Gene Symbol: GPR152
• Gene ID (NCBI): 390212
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR152 (G Protein-Coupled Receptor 152) is a G protein-coupled receptor. GPR152 is primarily expressed in the central nervous system (PMID: 15777626). Its role in GPCR signaling pathways suggests potential involvement in various physiological processes.