GPR17 Recombinant monoclonal antibody

GPR17 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86089-1-RR
Clone No.250471E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

G protein coupled receptor 17, G-protein coupled receptor 17, P2Y like receptor, P2Y-like receptor, R12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue, fetal human brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86089-1-RR targets GPR17 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4106

Product name: Recombinant human GPR17 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-91 aa of BC031653

Sequence: VPYHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESSLSAKSEL

Predict reactive species
Full Name G protein-coupled receptor 17
Calculated Molecular Weight 367 aa, 41 kDa
Observed Molecular Weight48 kDa
GenBank Accession NumberBC031653
Gene Symbol GPR17
Gene ID (NCBI) 2840
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13304
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR17 is a G protein-coupled receptor (GPCR) that plays a significant role in various physiological processes, particularly in the central nervous system (CNS). GPR17 is considered a modulator of CNS myelination and is involved in reconstructing and repairing demyelinating plaques caused by ongoing inflammatory processes, such as in multiple sclerosis (MS). It is present in nerve cells and precursor oligodendrocyte cells, playing a role in the differentiation and maturation of oligodendrocytes (PMID: 32182666). GPR17 is a multifaceted GPCR with implications in immune regulation, glucose metabolism, neurodegenerative diseases, and potentially in treating anxiety disorders.

Protocols

Product Specific Protocols
WB protocol for GPR17 antibody 86089-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...