GPR172B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR172B Polyclonal antibody, PBS Only (20791-1-PBS)

• 

  WB analysis using 20791-1-AP (same clone as 20791-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20791-1-AP (GPR172B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20791-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20791-1-AP (same clone as 20791-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20791-1-AP (GPR172B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20791-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 20791-1-AP (same clone as 20791-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20791-1-AP (GPR172B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20791-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 20791-1-AP (same clone as 20791-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20791-1-AP (GPR172B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20791-1-PBS in a different storage buffer formulation.

GPR172B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20791-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

GPCR42, hRFT1, PAR2, PERV A receptor 2, Protein GPR172B

---

Product Information

20791-1-PBS targets GPR172B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14525

  Product name: Recombinant human GPR172B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 201-290 aa of BC060810

  Sequence: TALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTS

• Full Name: G protein-coupled receptor 172B
• Calculated Molecular Weight: 448 aa, 46 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC060810
• Gene Symbol: GPR172B
• Gene ID (NCBI): 55065
• RRID: AB_3742004
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWF4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPR172B, also known as solute carrier family 52 member 1 (SLC52A1) or riboflavin transporter 1 (RFT1), is a G protein-coupled receptor (GPCR) that plays a significant role in the transport of riboflavin, a vital component for the production of flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN). GPR172B plays a role in cellular aging. Knockdown of GPR172B promotes senescence induced by DNA damage in both tumor and normal cells. The anti-senescence effect of GPR172B is dependent on its riboflavin transport activity, which leads to the activation of mitochondrial membrane potential (MMP) mediated by mitochondrial electron transport chain complex II, ultimately inhibiting the AMPK-p53 pathway, a central mediator of senescence-associated with mitochondrial dysfunction.