GPR175 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR175 Polyclonal antibody, PBS Only (33499-1-PBS)

• 

  WB analysis using 33499-1-AP (same clone as 33499-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 33499-1-AP (GPR175 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33499-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 33499-1-AP (same clone as 33499-1-PBS)

  Human placenta tissue were subjected to SDS PAGE followed by western blot with 33499-1-AP (GPR175 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33499-1-PBS in a different storage buffer formulation.

GPR175 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33499-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Integral membrane protein GPR175, PP6566, TMEM227, TPRA1, TPRA40

---

Product Information

33499-1-PBS targets GPR175 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39379

  Product name: Recombinant human GPR175 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 286-373 aa of BC050711

  Sequence: SEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAINA

• Full Name: G protein-coupled receptor 175
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC050711
• Gene Symbol: GPR175
• Gene ID (NCBI): 131601
• RRID: AB_3742992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86W33
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPR175, also known as TPRA1 or TPRA40, is a transmembrane protein. GPR175 was first cloned as a GLP-1 receptor homolog in 3T3-L1 adipocytes and is also expressed in tissues that require Hh signaling during development, including the heart, brain, lung, pancreas, and muscle. Endogenous GPR175 localizes to cilia in a Hh-dependent manner, where it can interact with (constitutively) ciliary Gαi1 to inhibit the local production of cAMP by adenylyl cyclase. The calculated molecular weight of GPR175 is 41 kDa. With glycosylation modification, the molecular weight of GPR175 will be migrated to 55 kDa. (PMID: 26451044)