GPR176 Polyclonal antibody

• 

GPR176 Polyclonal Antibody for ELISA

Cat No. 16923-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

G protein coupled receptor 176, Gm1012, GPR, GPR176, HB 954

---

Product Information

16923-1-AP targets GPR176 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10292

  Product name: Recombinant human GPR176 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 325-514 aa of BC067106

  Sequence: SVRKCLIGTLVQLHHRYSRRNVVSTGSGMAEASLEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFSTCLEGEQGPQFAPSAPPLSTVDSVSQVAPAAPVEPETFPDKYSLQFGFGPFELPPQWLSETRNSKKRLLPPLGNTPEELIQTKVPKVGRVERKMSRNNKVSIFPKVDS

• Full Name: G protein-coupled receptor 176
• Calculated Molecular Weight: 514 aa, 57 kDa
• GenBank Accession Number: BC067106
• Gene Symbol: GPR176
• Gene ID (NCBI): 11245
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14439
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.