GPR180 Polyclonal antibody

• 

  WB analysis using 16691-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16691-1-AP (GPR180 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

GPR180 Polyclonal Antibody for WB, ELISA

Cat No. 16691-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Integral membrane protein GPR180, Intimal thickness-related receptor, ITR

---

Tested Applications

• Positive WB detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16691-1-AP targets GPR180 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10052

  Product name: Recombinant human GPR180 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-170 aa of BC052243

  Sequence: QGSQGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINNIAVAVGKEAKLYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQTWHVFYADKYTCQDDKENSQVEDIPFEMVLLNPDAEGNPFDHFSAGESGL

• Full Name: G protein-coupled receptor 180
• Calculated Molecular Weight: 440 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC052243
• Gene Symbol: GPR180
• Gene ID (NCBI): 160897
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86V85
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR180 is an orphan GPCR, also known as the Endothelial Thickness-Related Receptor (ITR), and is a member of the GOLDS domain seven transmembrane helix (GOST) protein family. This receptor was initially discovered to promote the proliferation of vascular smooth muscle cells, leading to subsequent thickening of the vascular intima. GPR180 interacts with CTHRC1 to regulate the TGFβ signaling pathway, influencing energy metabolism and thermogenic function ( PMID: 34880217).