GPR34 Polyclonal antibody

• 

  WB analysis using 22149-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22149-1-AP (GPR34 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 22149-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22149-1-AP (GPR34 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GPR34 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22149-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

G protein coupled receptor 34, Probable G-protein coupled receptor 34

---

Tested Applications

• Positive WB detected in: rat brain tissue, mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22149-1-AP targets GPR34 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17742

  Product name: Recombinant human GPR34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 267-381 aa of BC020678

  Sequence: NSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST

• Full Name: G protein-coupled receptor 34
• Calculated Molecular Weight: 381 aa, 44 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC020678
• Gene Symbol: GPR34
• Gene ID (NCBI): 2857
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPC5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

G protein-coupled receptor 34 (GPR34) is a 7-transmembrane orphan receptor, belonging to the GPCR family, which affects multiple biological and physiological functions, such as cell proliferation and motility, immune infiltration, gene transcription.