GPR37 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87095-1-RR (same clone as 87095-1-PBS)

  K-562 cells lysates were subjected to SDS PAGE followed by western blot with 87095-1-RR (GPR37 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87095-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 87095-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87095-1-RR against Human GPR37 were performed. The affinity constant is 1.59 nM.

GPR37 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87095-1-PBS

Clone No.252205H3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

GPR37/Pael-R, Pael-R, EDNRBL, Endothelin B receptor-like protein 1, ETBR LP 1

---

Product Information

87095-1-PBS targets GPR37 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5426

  Product name: Recombinant human GPR37 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-265 aa of NM_005302.5

  Sequence: ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVM

• Full Name: G protein-coupled receptor 37 (endothelin receptor type B-like)
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: NM_005302.5
• Gene Symbol: GPR37
• Gene ID (NCBI): 2861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15354
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The orphan G protein-coupled receptor GPR37, also known as PAELR (parkin-associated endothelin receptor-like receptor) or ETBR-LP-1 (endothelin B receptor-like protein 1), is a 613 aa, multi-pass membrane protein predominantly expressed in the brain. It is a substrate of parkin (PARK2). When overexpressed in cells, GPR37 tends to become insoluble, unfolded, and ubiquitinated in vivo. Accumulation of the unfolded protein may lead to dopaminergic neuronal death in juvenile Parkinson disease (JPD). This antibody recognizes endogenous GPR37, which migrates as an approximately 50-55 kDa band in SDS-PAGE (PMID:17519329).