GPR37/Pael-R Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR37/Pael-R Polyclonal antibody, PBS Only (29989-1-PBS)

• 

  WB analysis using 29989-1-AP (same clone as 29989-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29989-1-AP (GPR37 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29989-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 29989-1-AP (same clone as 29989-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 29989-1-AP (GPR37/Pael-R antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29989-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 29989-1-AP (same clone as 29989-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 29989-1-AP (GPR37/Pael-R antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29989-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GPR37/Pael-R Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29989-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

GPR37, Pael-R, EDNRBL, Endothelin B receptor-like protein 1, ETBR LP 1

---

Product Information

29989-1-PBS targets GPR37/Pael-R in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32431

  Product name: Recombinant human GPR37 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-180 aa of BC040007

  Sequence: SRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF

• Full Name: G protein-coupled receptor 37 (endothelin receptor type B-like)
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC040007
• Gene Symbol: GPR37
• Gene ID (NCBI): 2861
• RRID: AB_2935493
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15354
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The orphan G protein-coupled receptor GPR37, also known as PAELR (parkin-associated endothelin receptor-like receptor) or ETBR-LP-1 (endothelin B receptor-like protein 1), is a 613 aa, multi-pass membrane protein predominantly expressed in the brain. It is a substrate of parkin (PARK2). When overexpressed in cells, GPR37 tends to become insoluble, unfolded, and ubiquitinated in vivo. Accumulation of the unfolded protein may lead to dopaminergic neuronal death in juvenile Parkinson disease (JPD).