Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Human GPR56 Rabbit Recombinant Antibody, PBS Only (98291-1-PBS)

Anti-Human GPR56 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Human GPR56 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98291-1-PBS-1MG

GPR56 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98291-1-PBS

Clone No. 242249A7

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

242249A7, ADGRG1, ADGRG1 CT, ADGRG1 C-terminal fragment, ADGRG1 NT

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC

FC experiment of human peripheral blood leukocytes using 98291-1-RR (same clone as 98291-1-PBS)
1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human GPR56 Rabbit RecAb (98291-1-RR, Clone: 242249A7) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 647 Anti-Human NCAM1/CD56 Rabbit Recombinant Antibody (CL647-98033, Clone: 240078A7). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98291-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human GPR56 Rabbit RecAb (98291-1-RR, Clone: 242249A7) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 647 Anti-Human NCAM1/CD56 Rabbit Recombinant Antibody (CL647-98033, Clone: 240078A7). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98291-1-PBS in a different storage buffer formulation.
FC experiment of human peripheral blood leukocytes using 98291-1-RR (same clone as 98291-1-PBS)
1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human GPR56 Rabbit RecAb (98291-1-RR, Clone: 242249A7)(red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98291-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human GPR56 Rabbit RecAb (98291-1-RR, Clone: 242249A7)(red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98291-1-PBS in a different storage buffer formulation.

Able AI

What's the best dilution for GPR56 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98291-1-PBS targets GPR56 in FC applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2478 Product name: Recombinant Human GPR56 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 26-171 aa of NM_001145771.2 Sequence: RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHN Predict reactive species
Full Name	G protein-coupled receptor 56
Calculated Molecular Weight	78 kDa
GenBank Accession Number	NM_001145771.2
Gene Symbol	GPR56
Gene ID (NCBI)	9289
RRID	AB_3745957
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9Y653
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

GPR56 (G-protein-coupled receptor 56, also named ADGRG1) is a member of the adhesion G-protein coupled receptor (aGPCR) family and one of the important players in the normal development of the brain. It plays a pivotal role in diverse neurobiological processes, including cortical formation, oligodendrocyte development, and myelination (PMID: 32798453). Moreover, GPR56 has been reported to regulate VEGF secretion and angiogenesis in melanoma (PMID: 37579299).