Product Information
20306-1-PBS targets GPR65 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14139 Product name: Recombinant human GPR65 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 238-337 aa of BC035633 Sequence: CFTPFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTSLNCVADPILYCFVTETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE Predict reactive species |
| Full Name | G protein-coupled receptor 65 |
| Calculated Molecular Weight | 337 aa, 39 kDa |
| GenBank Accession Number | BC035633 |
| Gene Symbol | GPR65 |
| Gene ID (NCBI) | 8477 |
| RRID | AB_2878668 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IYL9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GPR65 (G protein-coupled receptor 65) was defined originally as T-cell death-associated gene 8 (TDAG8), functions as a proton-sensing receptor, and is also sensitive to psychosine (PMID: 35343079). GPR65 promotes adaptation to an acidic environment to enhance cell survival and proliferation, thereby promoting tumor development (PMID: 36852075).









