GPR87 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR87 Polyclonal antibody, PBS Only (25999-1-PBS)

• 

  IHC staining of mouse bladder using 25999-1-AP (same clone as 25999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 25999-1-AP (GPR87 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse bladder using 25999-1-AP (same clone as 25999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 25999-1-AP (GPR87 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25999-1-PBS in a different storage buffer formulation.

GPR87 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25999-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

25999-1-PBS targets GPR87 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23214

  Product name: Recombinant human GPR87 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-47 aa of BC132888

  Sequence: MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPV

• Full Name: G protein-coupled receptor 87
• GenBank Accession Number: BC132888
• Gene Symbol: GPR87
• Gene ID (NCBI): 53836
• RRID: AB_3085833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BY21
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

G Protein-Coupled Receptor 87 (GPR87) is a GPCR, and it has been demonstrated to regulate the progression of several tumors (PMID:18183596). Studied reported that GPR87 promotes PDA (Pancreatic ductal adenocarcinoma) proliferation, angiogenesis, gemcitabine resistance, and tumorigenicity through activating the nuclear factor-kB (NF-kB) pathway (PMID:32405536). GPR87 is an independent prognostic factor for bladder cancer intravesical recurrence; it promotes bladder cancer cell proliferation and inhibits apoptosis. In addition, GPR87 was deorphanized and shown to be a lysophosphatidic acid (LPA) receptor (PMID:23752273).