GPX3 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GPX3 Recombinant monoclonal antibody, PBS Only (86650-2-PBS)

• 

  WB analysis using 86650-2-RR (same clone as 86650-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86650-2-RR (GPX3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86650-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 86650-2-RR (same clone as 86650-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 86650-2-RR (GPX3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86650-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 86650-2-RR (same clone as 86650-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using GPX3 antibody (86650-2-RR, Clone: 251602E9 ) at dilution of 1:500 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86650-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 86650-2-RR (same clone as 86650-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using GPX3 antibody (86650-2-RR, Clone: 251602E9 ) at dilution of 1:500 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86650-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86650-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86650-2-RR against Human GPX3 were performed. The affinity constant is below 1 pM.

GPX3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 86650-2-PBS

Clone No.251602E9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

EC:1.11.1.9, Glutathione peroxidase 3, GPx 3, GPx P, GPx-3

---

Product Information

86650-2-PBS targets GPX3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5054

  Product name: Recombinant human GPX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of BC050378

  Sequence: MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASY

• Full Name: glutathione peroxidase 3 (plasma)
• Calculated Molecular Weight: 226 aa, 26 kDa
• Observed Molecular Weight: 20-27 kDa
• GenBank Accession Number: BC050378
• Gene Symbol: GPX3
• Gene ID (NCBI): 2878
• RRID: AB_3745029
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22352
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPX3 (glutathione peroxidase 3) is also named as Plasma Glutathione Peroxidase. GPX3 can protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. GPX3 is secreted into plasma and like GPX1, is an 100 kDa homotetramer consisting of four identical 23 kDa subunits, each containing a selenocysteine residue at the active site. It can be detected a band of 20 kDa which is considered as the chain A of GPX3 (selenocysteine to glycine mutant).