Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

GPX4 Monoclonal antibody

GPX4 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 67763-1-Ig
Clone No. 3F5G5
Publications (1469)
Reviews (10)
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

3F5G5, EC:1.11.1.12, EC:1.11.1.9, GPx 4, GPx-4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for GPX4 in ?

Tested Applications

Positive WB detected inEC109 cells, HEK-293 cells, NCCIT cells, pig brain tissue, rabbit testis tissue, Hela cells, HepG2 cells, Jurkat cells, HSC-T6 cells, 4T1 cells, ATDC-5 cells, MDCK cells, CHO cells, Chicken brain tissue, Zebrafish tissue, human platelet tissue, rat brain tissue, mouse brain tissue, rabbit brain tissue, rat testis tisssue, mouse testis tissue
Positive IHC detected inhuman liver cancer tissue, mouse testis tissue, rat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse testis tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67763-1-Ig targets GPX4 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster samples.

Tested Reactivity human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster
Cited Reactivityhuman, mouse, rat, pig, rabbit, chicken, zebrafish, sheep, goat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30650

Product name: Recombinant human GPX4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 107-197 aa of BC021567

Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Predict reactive species
Full Name glutathione peroxidase 4 (phospholipid hydroperoxidase)
Observed Molecular Weight 20-23 kDa
GenBank Accession NumberBC021567
Gene Symbol GPX4
Gene ID (NCBI) 2879
RRIDAB_2909469
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP36969
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.

Protocols

Product Specific Protocols
IF protocol for GPX4 antibody 67763-1-IgDownload protocol
IHC protocol for GPX4 antibody 67763-1-IgDownload protocol
WB protocol for GPX4 antibody 67763-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-GPX4 antibody (Cat# 67763-1-Ig) has accumulated 1,469 citations published in high-impact journals including Cell, Nature Communications, Nature Cell Biology, Advanced Science, Redox Biology, Cell Death & Disease, Biomaterials, ACS Nano, Journal of Advanced Research, and Autophagy. Associated research fields span ferroptosis mechanisms, oncology, neuroscience, cardiovascular disease, immunology, nanomedicine, liver/kidney pathology, bone biology, pulmonary medicine, diabetes, and inflammation. The antibody is predominantly applied in Western blot, immunohistochemistry, and immunofluorescence.

SpeciesApplicationTitle
mouseIHC

Signal Transduct Target Ther

Elaiophylin triggers paraptosis and preferentially kills ovarian cancer drug-resistant cells by inducing MAPK hyperactivation

Authors - Guan-Nan Li

Signal Transduct Target Ther

Two stress-responsive kinases suppress ferroptosis by activating antioxidant programs under mild oxidative stress.

Authors - Yumiko Fujikawa
mouse,humanWB

Cell

Extracellular GPX4 impairs antitumor immunity via dendritic ZP3 receptors.

Authors - Jiao Liu
  • KO Validated
mouseWB

Cell

Uncovering spatially resolved functional genomics with CRISPR screen sequencing.

Authors - Haorui Zhang
humanWB

Cell Metab

Iron-addicted colorectal cancers exploit heme-complex II axis to resist oxidative cell death.

Authors - Chesta Jain
rat,mouseWB,IHC

Adv Mater

Biomimetic Nanomotors for Deep Ischemia Penetration and Ferroptosis Inhibition in Neuroprotective Therapy of Ischemic Stroke

Authors - Rui Wang

Reviews

    4.9 out of 5
Add a review

10 verified customer reviews

What customers say

All 10 reviews are highly positive (average ~4.9/5). Users consistently report clear, specific bands in Western Blot across mouse heart, breast cancer, bladder cancer, and 231 cell lines. The antibody also performs well in IHC (mouse retina, paraffin-embedded sections), immunofluorescence (ovarian tissue), and immunoprecipitation. One reviewer confirmed its specificity using GPX4 knockout cells. Cross-reactivity in both human and mouse lysates was verified. Recommended dilutions range from 1:100 to 1:5000 depending on the application. Several users noted it outperformed alternatives from other manufacturers.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Xinyi (Verified Customer) (08-28-2026)

Bands are clear and specific in our mouse heart tissue protein samples.

  • Applications: Western Blot
  • Cell Tissue Type: Mouse heart tissue

Mounika (Verified Customer) (01-08-2026)

Western blot bands are excellent and brightness is wonderfull!

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:1000

Sai Sindhura (Verified Customer) (01-08-2026)

GPX4 antibody works very well

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:5000

Vignesh (Verified Customer) (11-07-2025)

Excellent antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: 231 cells

Prakash (Verified Customer) (10-28-2025)

It works very well in western blot

  • Applications: Western Blot
  • Cell Tissue Type: bladder cancer cell lines

Pooja (Verified Customer) (09-08-2025)

mouse retina paraffin embedded section incubated with the GPx4 antibody (1:100 dilution) at 4 degree overnight.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse retina
GPX4 Antibody Immunohistochemistry validation (1:100 dilution) in Mouse retina (Cat no:67763-1-Ig)

Breanna (Verified Customer) (08-11-2025)

The antibody worked well when testing my GPX4 KO cells! Highly recommend.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000

Rajeshkumar (Verified Customer) (07-23-2025)

works very good for human and mic lysates

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1-1000
  • Cell Tissue Type: Human and mouse

Vasu (Verified Customer) (09-23-2024)

We evaluated antibodies from various manufacturers but failed to achieve satisfactory results. However, using the ProteinTech antibody, we successfully detected robust and specific bands corresponding to the expected protein size.

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Flow Cytometry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Breast Cancer and other cancer cells and tumor tissue samples

Tianyi (Verified Customer) (08-17-2023)

Paraffine-embedded ovarian tissue (4% PFA, 24 h) incubated with GPX4 (1:200 dilution) and secondary antibody Alexa fluor donkey anti-mouse 647 IgG (H+L).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Ovarian tissue
GPX4 Antibody Immunofluorescence validation (1:200 dilution) in Ovarian tissue (Cat no:67763-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...