GPX4 Recombinant monoclonal antibody, PBS Only (Detector)

GPX4 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 82949-1-PBS
Clone No.230168A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

230168A8, EC:1.11.1.12, EC:1.11.1.9, GPx 4, GPx-4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82949-1-PBS targets GPX4 as part of a matched antibody pair:

MP00049-3: 82949-4-PBS capture and 82949-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5809

Product name: Recombinant human GPX4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-72 aa of BC022071

Sequence: MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ

Predict reactive species
Full Name glutathione peroxidase 4 (phospholipid hydroperoxidase)
Calculated Molecular Weight 22 kDa
GenBank Accession NumberBC022071
Gene Symbol GPX4
Gene ID (NCBI) 2879
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP36969
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.

Loading...
||
New chat Able
正在加载,请稍候...