GPX7 Polyclonal antibody

• 

  WB analysis of human liver using 13501-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13501-1-AP (GPX7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13501-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13501-1-AP (GPX7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 13501-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13501-1-AP (GPX7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Transfected HEK-293 using 13501-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 13501-1-AP (GPX7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 13501-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13501-1-AP (GPX7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 13501-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13501-1-AP (GPX7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 13501-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 13501-1-AP (GPX7 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 13501-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 13501-1-AP (GPX7 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human brain using 13501-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 13501-1-AP (GPX7 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 13501-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 13501-1-AP (GPX7 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

GPX7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13501-1-AP

Publications(17)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, ELISA

Synonyms

CL683, EC:1.11.1.9, GPx 7, GPX6, GPx-7

---

Tested Applications

• Positive WB detected in: human liver tissue, human placenta tissue, human brain tissue, Transfected HEK-293 cells
• Positive IHC detected in: human liver cancer tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 14 publications below
• IHC: See 4 publications below
• IF: See 2 publications below

Product Information

13501-1-AP targets GPX7 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4328

  Product name: Recombinant human GPX7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 58-187 aa of BC032788

  Sequence: GFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

• Full Name: glutathione peroxidase 7
• Calculated Molecular Weight: 187 aa, 21 kDa
• Observed Molecular Weight: 18-21 kDa
• GenBank Accession Number: BC032788
• Gene Symbol: GPX7
• Gene ID (NCBI): 2882
• RRID: AB_2112560
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96SL4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPX7(Glutathione peroxidase 7) is also named as GPX6,CL683,GSHPx-7 and belongs to the glutathione peroxidase family.It shares approximately 45% amino acid sequence with other GPX family members.Because GPX7 expression protected cells from acidic bile acidinduced DNA damage, it may protect oesophageal epithelial cells from acidic bile acid-induced apoptosis(PMID:22157330). This antibody can ve detected as 18-21kDa due to signal peptide splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Gut; Glutathione peroxidase 7 protects against oxidative DNA damage in oesophageal cells.; Authors - Peng Dunfa D
human	WB	Gut; Glutathione peroxidase 7 has potential tumour suppressor functions that are silenced by location-specific methylation in oesophageal adenocarcinoma.; Authors - Peng Dunfa D
mouse	WB	EMBO Mol Med; Deficiency of NPGPx, an oxidative stress sensor, leads to obesity in mice and human.; Authors - Chang Yi-Cheng YC
human	IHC	Oncogene; Abrogation of glutathione peroxidase-1 drives EMT and chemoresistance in pancreatic cancer by activating ROS-mediated Akt/GSK3β/Snail signaling.; Authors - Qingcai Meng
human	WB	Carcinogenesis; Loss of glutathione peroxidase 7 promotes TNF-α-induced NF-κB activation in Barrett's carcinogenesi.; Authors - Dun-Fa Peng ; KD Validated
	WB	Free Radic Biol Med; GPx8 peroxidase prevents leakage of H2O2 from the endoplasmic reticulum.; Authors - Thomas Ramming