GRB10 Recombinant monoclonal antibody, PBS Only

GRB10 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 81225-1-PBS
Clone No.1D13

Host / Isotype

Rabbit / IgG

Reactivity

rat, mouse, human

Applications

WB, IF/ICC, Indirect ELISA

KIAA0207, Insulin receptor-binding protein Grb-IR, Growth factor receptor-bound protein 10, GRBIR, 1D13

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81225-1-PBS targets GRB10 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with rat, mouse, human samples.

Tested Reactivity rat, mouse, human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20355

Product name: Recombinant human GRB10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-80 aa of BC024285

Sequence: MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAI

Predict reactive species
Full Name growth factor receptor-bound protein 10
Calculated Molecular Weight536aa,61 kDa; 594aa,67 kDa
Observed Molecular Weight60-70 kDa
GenBank Accession NumberBC024285
Gene Symbol GRB10
Gene ID (NCBI) 2887
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13322
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GRB10 is an adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. GRB10 has three consensus domains including pleckstrin homology (PH) domain, SH2/SH3 domain and Ras-associating domain. By binding to kinases, GRB10 suppresses signals from activated receptors tyrosine kinases, including INSR and IGF1R. It may play a role in mediating ubiquitination of INSR, leading to proteasomal degradation. GRB10 has 4 isoforms with the molecular mass of 60-70 kDa, which are produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...