GRB10 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81225-1-RR (same clone as 81225-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81225-1-RR (GRB10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81225-1-PBS in a different storage buffer formulation.

• 

  IF Staining of LNCaP using 81225-1-RR (same clone as 81225-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed LNCaP cells using GRB10 antibody (81225-1-RR, Clone: 1D13 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 81225-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81225-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81225-1-RR against Human GRB10 were performed. The affinity constant is 0.195 nM.

GRB10 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 81225-1-PBS

Clone No.1D13

Host / Isotype

Rabbit / IgG

Reactivity

rat, mouse, human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

KIAA0207, Insulin receptor-binding protein Grb-IR, Growth factor receptor-bound protein 10, GRBIR, 1D13

---

Product Information

81225-1-PBS targets GRB10 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with rat, mouse, human samples.

• Tested Reactivity: rat, mouse, human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20355

  Product name: Recombinant human GRB10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC024285

  Sequence: MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAI

• Full Name: growth factor receptor-bound protein 10
• Calculated Molecular Weight: 536aa,61 kDa; 594aa,67 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC024285
• Gene Symbol: GRB10
• Gene ID (NCBI): 2887
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13322
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRB10 is an adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. GRB10 has three consensus domains including pleckstrin homology (PH) domain, SH2/SH3 domain and Ras-associating domain. By binding to kinases, GRB10 suppresses signals from activated receptors tyrosine kinases, including INSR and IGF1R. It may play a role in mediating ubiquitination of INSR, leading to proteasomal degradation. GRB10 has 4 isoforms with the molecular mass of 60-70 kDa, which are produced by alternative splicing.