GRB14 Polyclonal antibody

• 

  WB analysis of DU 145 using 15298-1-AP

  DU 145 cells were subjected to SDS PAGE followed by western blot with 15298-1-AP (GRB14 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 15298-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 15298-1-AP (GRB14 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary tumor using 15298-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 15298-1-AP (GRB14 antibody) at dilution of 1:50 (under 40x lens).

GRB14 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15298-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GRB14, GRB14 adapter protein

---

Tested Applications

• Positive WB detected in: DU 145 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

15298-1-AP targets GRB14 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7554

  Product name: Recombinant human GRB14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 225-540 aa of BC053559

  Sequence: LQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGCSSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSPTASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL

• Full Name: growth factor receptor-bound protein 14
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC053559
• Gene Symbol: GRB14
• Gene ID (NCBI): 2888
• RRID: AB_2112892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14449
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRB14 belongs to the GRB7/10/14 family. It is an adapter protein which modulates coupling of cell surface receptor kinases with specific signaling pathways. GRB14 is a target for a PDGF regulated serine kinase, an interaction that does not require PDGFR-GRB14 association. GRB14 is about 58-65kd in WB test.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biochim Biophys Acta Mol Basis Dis; Harnessing integrated bioinformatics to identify new diagnostic and therapeutic strategies for heart failure; Authors - Shuo Sun