GRIA1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85333-1-RR (same clone as 85333-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85333-1-RR (GRIA1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85333-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85333-1-RR (same clone as 85333-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85333-1-RR (GRIA1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85333-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85333-1-RR (same clone as 85333-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85333-1-RR (GRIA1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85333-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85333-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85333-1-RR against Human GRIA1 were performed. The affinity constant is below 1 pM.

GRIA1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85333-1-PBS

Clone No.242387E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

242387E7, AMPA-selective glutamate receptor 1, GluA1, GLUH1, GluR 1

---

Product Information

85333-1-PBS targets GRIA1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21502

  Product name: Recombinant human GRIA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-249 aa of BC111734

  Sequence: LRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGAN

• Full Name: glutamate receptor, ionotropic, AMPA 1
• Calculated Molecular Weight: 906 aa, 102 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC111734
• Gene Symbol: GRIA1
• Gene ID (NCBI): 2890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42261
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors.