GRIA1 Recombinant monoclonal antibody

GRIA1 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 85333-1-RR
Clone No.242387E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

242387E7, AMPA-selective glutamate receptor 1, GluA1, GLUH1, GluR 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat cerebellum tissue, mouse brain tissue, rat brain tissue, pig brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85333-1-RR targets GRIA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21502

Product name: Recombinant human GRIA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 125-249 aa of BC111734

Sequence: LRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGAN

Predict reactive species
Full Name glutamate receptor, ionotropic, AMPA 1
Calculated Molecular Weight 906 aa, 102 kDa
Observed Molecular Weight100 kDa
GenBank Accession NumberBC111734
Gene Symbol GRIA1
Gene ID (NCBI) 2890
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42261
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors.

Protocols

Product Specific Protocols
IHC protocol for GRIA1 antibody 85333-1-RRDownload protocol
WB protocol for GRIA1 antibody 85333-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...