GRIA4 Polyclonal antibody

• 

  WB analysis of rat brain using 23350-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 23350-1-AP (GRIA4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 23350-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 23350-1-AP (GRIA4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse cerebellum using 23350-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 23350-1-AP (GRIA4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 23350-1-AP

  IP result of anti-GRIA4 (IP:23350-1-AP, 4ug; Detection:23350-1-AP 1:300) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of mouse brain using 23350-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 23350-1-AP (GRIA4 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of mouse brain using 23350-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 23350-1-AP (GRIA4 Antibody) at dilution of 1:50 (under 40x lens).

GRIA4 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 23350-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

GluA4, GluR 4, GluR D, GLUR4, GLUR4C, GLURD, Glutamate receptor 4, GRIA4

---

Tested Applications

• Positive WB detected in: rat brain tissue, mouse brain tissue, mouse cerebellum tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 3 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

23350-1-AP targets GRIA4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19949

  Product name: Recombinant human GRIA4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 87-229 aa of BC167786

  Sequence: YSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVG

• Full Name: glutamate receptor, ionotrophic, AMPA 4
• Calculated Molecular Weight: 902 aa, 101 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: BC167786
• Gene Symbol: GRIA4
• Gene ID (NCBI): 2893
• RRID: AB_2879262
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48058
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Human	IHC,IF	Nature; A single-cell atlas of human and mouse white adipose tissue.; Authors - Margo P Emont
mouse	WB	Mol Psychiatry; A recurrent SHANK1 mutation implicated in autism spectrum disorder causes autistic-like core behaviors in mice via downregulation of mGluR1-IP3R1-calcium signaling.; Authors - Yue Qin
human	WB	J Clin Invest; TMEM25 modulates neuronal excitability and NMDA receptor subunit NR2B degradation.; Authors - Haiqing Zhang
mouse	IP	Cell Death Dis; ZDHHC8 critically regulates seizure susceptibility in epilepsy.; Authors - Qin Yang
human	WB	Front Cell Dev Biol; Olfactomedin-3 Enhances Seizure Activity by Interacting With AMPA Receptors in Epilepsy Models.; Authors - Shirong Tang
mouse	WB	Mol Brain; Assessments of prolonged effects of desflurane and sevoflurane on motor learning deficits in aged AppNL-G-F/NL-G-F mice.; Authors - Ryo Niikura