GRID1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GRID1 Polyclonal antibody, PBS Only (13040-1-PBS)

• 

  WB analysis of human brain using 13040-1-AP (same clone as 13040-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 13040-1-AP (GRID1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13040-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 13040-1-AP (same clone as 13040-1-PBS)

  IP result of anti-GRID1 (IP:13040-1-AP, 4ug; Detection:13040-1-AP 1:300) with mouse brain tissue lysate 5600ug. This data was developed using the same antibody clone with 13040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 13040-1-AP (same clone as 13040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13040-1-AP (GRID1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 13040-1-AP (same clone as 13040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13040-1-AP (GRID1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13040-1-AP (same clone as 13040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13040-1-AP (GRID1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13040-1-AP (same clone as 13040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13040-1-AP (GRID1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13040-1-AP (same clone as 13040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13040-1-AP (GRID1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13040-1-AP (same clone as 13040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13040-1-AP (GRID1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 13040-1-AP (same clone as 13040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 13040-1-AP (GRID1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 13040-1-AP (same clone as 13040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 13040-1-AP (GRID1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13040-1-PBS in a different storage buffer formulation.

GRID1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13040-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

GluD1, GluR delta 1 subunit, GluR delta-1 subunit, Glutamate receptor ionotropic, delta-1, KIAA1220

---

Product Information

13040-1-PBS targets GRID1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3694

  Product name: Recombinant human GRID1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-348 aa of BC039263

  Sequence: IHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCTRNNHRISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMAS

• Full Name: glutamate receptor, ionotropic, delta 1
• Calculated Molecular Weight: 1009 aa, 112 kDa
• Observed Molecular Weight: 100-112 kDa
• GenBank Accession Number: BC039263
• Gene Symbol: GRID1
• Gene ID (NCBI): 2894
• RRID: AB_10638439
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULK0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRID1 (Glutamate Ionotropic Receptor Delta Type Subunit 1) is a protein-coding gene that belongs to the family of ionotropic glutamate receptors. These receptors are crucial for rapid excitatory synaptic transmission and synaptic plasticity in the central nervous system. GRID1 is primarily expressed in various brain regions, including the cortex, hippocampus, amygdala, striatum, thalamus, nucleus accumbens, lateral hooked nucleus, and dorsal raphe nucleus. In the hippocampus, GRID1 is specifically expressed in the granule cells of the dentate gyrus.