GRID2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GRID2 Polyclonal antibody (21727-1-AP)

• 

  WB analysis using 21727-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21727-1-AP (GRID2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21727-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21727-1-AP (GRID2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 21727-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21727-1-AP (GRID2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 21727-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21727-1-AP (GRID2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GRID2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21727-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GluR delta 2 subunit, GLURD2

---

Tested Applications

• Positive WB detected in: mouse cerebellum tissue, rat cerebellum tissue
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21727-1-AP targets GRID2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16391

  Product name: Recombinant human GRID2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-358 aa of BC099652

  Sequence: SANADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQTEKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRK

• Full Name: glutamate receptor, ionotropic, delta 2
• Calculated Molecular Weight: 1007 aa, 113 kDa
• Observed Molecular Weight: 113 kDa
• GenBank Accession Number: BC099652
• Gene Symbol: GRID2
• Gene ID (NCBI): 2895
• RRID: AB_3742053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43424
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The GRID2 gene provides instructions for making a protein called the glutamate receptor ionotropic, delta-2 subunit (GluD2) . While it belongs to the family of ionotropic glutamate receptors, which are proteins that respond to the neurotransmitter glutamate by opening an ion channel, GluD2 is unique. It is often referred to as an "orphan" receptor because it does not bind glutamate or function as a typical ion channel. Instead, its primary roles are structural and organizational, critical for the development, maintenance, and function of specific synapses in the brain.