GRINA Polyclonal antibody

• 

  WB analysis using 20851-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20851-1-AP (GRINA antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 20851-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 20851-1-AP (GRINA antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 20851-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 20851-1-AP (GRINA antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GRINA Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20851-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Glutamate [NMDA] receptor-associated protein 1, HNRGW, LFG1, Protein lifeguard 1, Putative MAPK-activating protein PM02

---

Tested Applications

• Positive WB detected in: HeLa cells, human placenta tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20851-1-AP targets GRINA in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14716

  Product name: Recombinant human GRINA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC041788

  Sequence: MSHEKSFLVSGDNYPPPNPGYPGGPQPPMPPYAQPPYPGAPYPQPPFQPSPYGQPGYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQEGYPQGPYPQGGYPQGPYPQNPFPPNPYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLT

• Full Name: glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding)
• Calculated Molecular Weight: 371 aa, 41 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC041788
• Gene Symbol: GRINA
• Gene ID (NCBI): 2907
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z429
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutamate Receptor Ionotropic NMDA-Associated Protein 1 (GRINA, also known as TMBIM3) is a transmembrane protein involved in calcium homeostasis and cell survival. It plays a crucial role in regulating intracellular calcium levels, which are essential for processes such as cell survival, neurotransmitter release, and apoptosis (PMID: 32124700). GRINA also involves vesicle transport and sorting, particularly in secretory cells like neurons and mammary glands (PMID: 31426446). Additionally, GRINA has been implicated in regulating aerobic glycolysis and tumor progression in gastric cancer (PMID: 30541591).