GRK3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GRK3 Polyclonal antibody, PBS Only (13727-1-PBS)

• 

  WB analysis of K-562 using 13727-1-AP (same clone as 13727-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 13727-1-AP (GRK3 antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13727-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 13727-1-AP (same clone as 13727-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13727-1-AP (GRK3 antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13727-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 13727-1-AP (same clone as 13727-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 13727-1-AP (GRK3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13727-1-AP (same clone as 13727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13727-1-AP (GRK3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13727-1-AP (same clone as 13727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13727-1-AP (GRK3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13727-1-AP (same clone as 13727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 13727-1-AP (GRK3 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13727-1-AP (same clone as 13727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13727-1-AP (GRK3 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 13727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13727-1-AP (same clone as 13727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13727-1-AP (GRK3 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 13727-1-PBS in a different storage buffer formulation.

GRK3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13727-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

G protein-coupled receptor kinase 3, EC:2.7.11.15, Beta-ARK-2, Beta-adrenergic receptor kinase 2, ADRBK2

---

Product Information

13727-1-PBS targets GRK3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4685

  Product name: Recombinant human ADRBK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-387 aa of BC036797

  Sequence: MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRG

• Full Name: adrenergic, beta, receptor kinase 2
• Calculated Molecular Weight: 688 aa, 80 kDa
• Observed Molecular Weight: 70 kDa, 90 kDa
• GenBank Accession Number: BC036797
• Gene Symbol: GRK3
• Gene ID (NCBI): 157
• RRID: AB_2225851
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35626
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRK3 (G protein coupled receptor kinase 3), also known as ADRBK2 or BARK2, belongs to the G protein coupled receptor kinases (GRKs) family. GRKs are serine/threonine kinases that regulate a large and diverse class of G-protein coupled receptors (GPCRs). GRKs have been shown to play a critical role in the outcome of a variety of physiological and pathophysiological processes including chemotaxis, signaling, migration, inflammatory gene expression and so on (PMID: 28950947, 29483837). GRK3 was identified as a negative regulator of CXCL12/CXCR4 signaling, and has also been shown to be overexpressed in human prostate cancer and found to promote tumor growth and metastasis by enhancing angiogenesis (PMID: 23935208, 24434559). GRK3 has a molecular mass of 75-80 kDa, and also can be ubiquitinated (PMID: 20596523).