GRK4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GRK4 Polyclonal antibody, PBS Only (33470-1-PBS)

• 

  WB analysis using 33470-1-AP (same clone as 33470-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33470-1-AP (GRK4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33470-1-PBS in a different storage buffer formulation.

GRK4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33470-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

EC:2.7.11.16, G protein-coupled receptor kinase 4, G protein-coupled receptor kinase GRK4, GPRK2L, GPRK4

---

Product Information

33470-1-PBS targets GRK4 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38007

  Product name: Recombinant human GRK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 381-510 aa of NM_182982.2

  Sequence: QGHSPFKKYKEKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGAAGVKQHPVFKDINFRRLEANMLEPPFCPDPHAVYCKDVLDIEQFSVVKGIYLDTADEDFYARFATGCVSI

• Full Name: G protein-coupled receptor kinase 4
• Calculated Molecular Weight: NM_182982.2
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: NM_182982.2
• Gene Symbol: GRK4
• Gene ID (NCBI): 2868
• RRID: AB_3742984
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P32298
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

G protein-coupled receptor kinase 4 (GRK4) is a serine and threonine kinase that phosphorylates G protein-coupled receptors in response to agonist stimulation. It uncouples the dopamine receptor from its G protein. It should also be noted that kinase activity is not necessary for some GRK-mediated functions.