GRP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GRP Polyclonal antibody (28482-1-AP)

GRP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28482-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IHC, ELISA

Synonyms

BN, gastrin releasing peptide, GRP, GRP 10, preproGRP, proGRP

• 

  WB analysis using 28482-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 28482-1-AP (GRP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 28482-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28482-1-AP (GRP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 28482-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28482-1-AP (GRP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 28482-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28482-1-AP (GRP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 28482-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28482-1-AP (GRP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GRP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells
• Positive IHC detected in: human lung cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28482-1-AP targets GRP in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29357

  Product name: Recombinant human GRP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 49-120 aa of BC004488

  Sequence: LMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK

• Full Name: gastrin-releasing peptide
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16-18 kDa
• GenBank Accession Number: BC004488
• Gene Symbol: GRP
• Gene ID (NCBI): 2922
• RRID: AB_2881152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07492
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GRP Polyclonal antibody (Cat# 28482-1-AP) has 2 citations. One appears in Frontiers in Immunology (2022), studying a necroptosis-related gene index for prognosis prediction in stomach adenocarcinoma, reflecting its use in cancer immunology. The other is in Annals of the New York Academy of Sciences (2011), examining von Economo neurons in the frontoinsular and anterior cingulate cortex, representing neuroscience research. Both citations used IHC on human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Immunol; A novel necroptosis-related gene index for predicting prognosis and a cold tumor immune microenvironment in stomach adenocarcinoma; Authors - Muhammad Khan
human	IHC	Ann N Y Acad Sci; The von Economo neurons in the frontoinsular and anterior cingulate cortex.; Authors - John M Allman