GRP75 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GRP75 Recombinant monoclonal antibody, PBS Only (86721-1-PBS)

GRP75 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86721-1-PBS

Clone No.251670D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

HSPA9, 75 kDa glucose-regulated protein, CSA, GRP-75, Heat shock 70 kDa protein 9

• 

  WB analysis using 86721-1-RR (same clone as 86721-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86721-1-RR (GRP75 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86721-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 86721-1-RR (same clone as 86721-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86721-1-RR (GRP75 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86721-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 86721-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86721-1-RR against Human GRP75 were performed. The affinity constant is 1.66 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86721-1-PBS targets GRP75 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6673

  Product name: Recombinant human GRP75 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 331-679 aa of BC000478

  Sequence: YLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ

• Full Name: heat shock 70kDa protein 9 (mortalin)
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC000478
• Gene Symbol: GRP75
• Gene ID (NCBI): 3313
• RRID: AB_3745077
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P38646
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRP75 (also known as mortalin, HSPA9 or mt-Hsp70) is a constitutively expressed member of the HSPA (HSP70) family of heat-shock proteins. It is located in the mitochondrial matrix and anti-GRP75 is commonly used as the marker for mitochondria. It has been reported that GRP75 is enriched in cancer cells and contributes to carcinogenesis. In addition, decreased expression level of GRP75 has been found in neurodegenerative disorders like Parkinson's disease. (PMID: 21640711, 22920904)