GRWD1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86451-3-RR (same clone as 86451-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86451-3-RR (GRWD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86451-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86451-3-RR (same clone as 86451-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GRWD1 antibody (86451-3-RR, Clone: 251273F6 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86451-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 86451-3-RR (same clone as 86451-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using GRWD1 antibody (86451-3-RR, Clone: 251273F6 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86451-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86451-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86451-3-RR against Human GRWD1 were performed. The affinity constant is 0.203 nM.

GRWD1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86451-3-PBS

Clone No.251273F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Glutamate-rich WD repeat-containing protein 1, GRWD, KIAA1942, RRB1, WDR28

---

Product Information

86451-3-PBS targets GRWD1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0367

  Product name: Recombinant human GRWD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-236 aa of BC002440

  Sequence: AESGDTSSEGPAQVYLPGRGPPLREGEELVMDEEAYVLYHRAQTGAPCLSFDIVRDHLGDNRTELPLTLYLCAGTQAESAQSNRLMMLRMHNLHGTKPPPSEGSDEEEEEEDEEDEEERKPQLELAMVPHYGGINRVRVSWLGEEPVAGVWSEKGQVEVFALRRLLQVVEEPQALAAFLRDEQAQMKPIFSFAGHMGEGFALDWSPRVTGRLLTG

• Full Name: glutamate-rich WD repeat containing 1
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49-63 kDa
• GenBank Accession Number: BC002440
• Gene Symbol: GRWD1
• Gene ID (NCBI): 83743
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BQ67
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WD-repeat proteins are a class of functionally divergent molecules that cooperate with other proteins to regulate cellular processes. WD-repeat proteins have been implicated in a variety of cellular functions that are mostly regulatory in nature, including cytoskeleton organization, vesicular fusion, pre-mRNA splicing, and cell cycle regulation. WD-repeat-containing protein designated glutamate-rich WD repeat (GRWD1) is a component of the 50S and 80S preribosomal complexes and plays a role in ribosome biogenesis and during myeloid differentiation its levels are regulated. (PMID:15885502)