GSC Polyclonal antibody

• 

GSC Polyclonal Antibody for ELISA

Cat No. 14792-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

goosecoid homeobox, GSC, Homeobox protein goosecoid

---

Product Information

14792-1-AP targets GSC in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6477

  Product name: Recombinant human GSC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 4-257 aa of BC063580

  Sequence: SMFSIDNILAARPRCKDSVLPVAHSAAAPVVFPALHGDSLYGASGGASSDYGAFYPRPVAPGGAGLPAAVSGSRLGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS

• Full Name: goosecoid homeobox
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC063580
• Gene Symbol: GSC
• Gene ID (NCBI): 145258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56915
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.