GSG1L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GSG1L Polyclonal antibody (17328-1-AP)

GSG1L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17328-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Germ cell-specific gene 1-like protein, GSG1 like, GSG1 like protein, GSG1-like protein, PRO19651

• 

  WB analysis of U-251 using 17328-1-AP

  U-251 cells were subjected to SDS PAGE followed by western blot with 17328-1-AP (GSG1L antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17328-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17328-1-AP (GSG1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 17328-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17328-1-AP (GSG1L Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 17328-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17328-1-AP (GSG1L Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GSG1L in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Raji cells, U-251 cells, SGC-7901 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tissue
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17328-1-AP targets GSG1L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11307

  Product name: Recombinant human GSG1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC016460

  Sequence: MCLELFHSSNVIDGLKLNAFAAVFTVLSGLLGMVAHMMYTQVFQVTVSLGPEDWRPHSWDYGWSFCLAWGSFTCCMAASVTTLNSYTKTVIEFRHKRKVFEQGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLDCRHERYPARHQPHMADSWPRSSAQEAPELNRQCWVLGHWV

• Full Name: GSG1-like
• Calculated Molecular Weight: 176 aa, 21 kDa
• Observed Molecular Weight: 36-43 kDa
• GenBank Accession Number: BC016460
• Gene Symbol: GSG1L
• Gene ID (NCBI): 146395
• RRID: AB_2878384
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXU4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GSG1L is a component of the inner core of AMPAR complex. It modifies AMPA receptor (AMPAR) gating. GSG1L is mainly present on B lymphocytes. This antibody can recognize all the 4 isoforms of GSG1L. GSG1L was detected the isoform of 43 kDa in rat brain (PMID: 22813734).

Publications

What published studies show

The GSG1L Polyclonal antibody (Cat# 17328-1-AP) has 1 total citation. It was cited in Nature Communications (2023) in a study characterizing GSG1L-containing AMPA receptor complexes, including their spatiotemporal expression, native interactome, and allosteric sites. The research field is neuroscience, specifically AMPA receptor biology. The cited application used rat species.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat		Nat Commun; GSG1L-containing AMPA receptor complexes are defined by their spatiotemporal expression, native interactome and allosteric sites; Authors - Amanda M Perozzo