GSK3B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GSK3B Polyclonal antibody (24198-1-AP)

GSK3B Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 24198-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

GSK 3 beta, GSK3 beta, GSK3A B, GSK3B, GSK-3B, GSK3B 216P, gsk3beta

• 

  WB analysis of mouse brain using 24198-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24198-1-AP (GSK3B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 24198-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24198-1-AP (GSK3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 24198-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24198-1-AP (GSK3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24198-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24198-1-AP (GSK3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 24198-1-AP

  IP result of anti-GSK3B (IP:24198-1-AP, 4ug; Detection:24198-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 24198-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24198-1-AP (GSK3B Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 24198-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24198-1-AP (GSK3B Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 24198-1-AP

  Immunofluorescent analysis of Ethacrynic acid treated HeLa cells using 24198-1-AP (GSK3B antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GSK3B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells, PC-12 cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Ethacrynic acid treated HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24198-1-AP targets GSK3B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21438

  Product name: Recombinant human GSK3B protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-433 aa of BC000251

  Sequence: MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

• Full Name: glycogen synthase kinase 3 beta
• Calculated Molecular Weight: 433 aa, 48 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC000251
• Gene Symbol: GSK3B
• Gene ID (NCBI): 2932
• RRID: AB_2879451
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P49841
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GSK3B Polyclonal antibody (Cat# 24198-1-AP) has 7 citations published in Genes Dis, International Journal of Biological Macromolecules, International Immunopharmacology, Tumour Biology, Frontiers in Cardiovascular Medicine, Biomedical Research International, and Medicine (Baltimore). The research fields span bone biology and osteoblast differentiation, tissue engineering, hepatic gluconeogenesis in diabetes, fibrosis and keloid pathogenesis, cardiovascular disease (aortic aneurysm), Alzheimer's disease, and Wnt/β-catenin signaling. All cited applications are Western blot.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Genes Dis; Naked cuticle homolog 2 controls the differentiation of osteoblasts and osteoclasts and ameliorates bone loss in ovariectomized mice; Authors - Liying Shan
rat	WB	Int J Biol Macromol; Cranial repair-promoting effect of oxidised sodium alginate/amino gelatine injectable hydrogel loaded with deer antler blood peptides; Authors - Taojing Yu
mouse	WB	Int Immunopharmacol; Ginsenoside Rh2 mitigates hepatic gluconeogenesis by regulating Akt/FoxO1 pathway in type 2 diabetic mice.; Authors - Ya-Qian Gao ; KD Validated
human	WB	Tumour Biol; Downregulation of β-catenin blocks fibrosis via Wnt2 signaling in human keloid fibroblasts.; Authors - Yumei Cai
human	WB	Front Cardiovasc Med; Vascular Smooth Muscle FTO Promotes Aortic Dissecting Aneurysms via m6A Modification of Klf5.; Authors - Dong Ma
		Biomed Res Int; Administration of Repetitive Transcranial Magnetic Stimulation Attenuates Aβ1-42-Induced Alzheimer's Disease in Mice by Activating β-Catenin Signaling.; Authors - Xueyun Chen