GSK3B Polyclonal antibody

• 

  WB analysis of mouse brain using 24198-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24198-1-AP (GSK3B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 24198-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24198-1-AP (GSK3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24198-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24198-1-AP (GSK3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 24198-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24198-1-AP (GSK3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 24198-1-AP

  IP result of anti-GSK3B (IP:24198-1-AP, 4ug; Detection:24198-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human testis using 24198-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24198-1-AP (GSK3B Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 24198-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24198-1-AP (GSK3B Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 24198-1-AP

  Immunofluorescent analysis of Ethacrynic acid treated HeLa cells using 24198-1-AP (GSK3B antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.

GSK3B Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 24198-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

GSK 3 beta, GSK3 beta, GSK3A B, GSK3B, GSK-3B, GSK3B 216P, gsk3beta

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells, PC-12 cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Ethacrynic acid treated HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below

Product Information

24198-1-AP targets GSK3B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21438

  Product name: Recombinant human GSK3B protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-433 aa of BC000251

  Sequence: MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

• Full Name: glycogen synthase kinase 3 beta
• Calculated Molecular Weight: 433 aa, 48 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC000251
• Gene Symbol: GSK3B
• Gene ID (NCBI): 2932
• RRID: AB_2879451
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P49841
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Int J Biol Macromol; Cranial repair-promoting effect of oxidised sodium alginate/amino gelatine injectable hydrogel loaded with deer antler blood peptides; Authors - Taojing Yu
mouse	WB	Genes Dis; Naked cuticle homolog 2 controls the differentiation of osteoblasts and osteoclasts and ameliorates bone loss in ovariectomized mice; Authors - Liying Shan
human	WB	Front Cardiovasc Med; Vascular Smooth Muscle FTO Promotes Aortic Dissecting Aneurysms via m6A Modification of Klf5.; Authors - Dong Ma
human	WB	Tumour Biol; Downregulation of β-catenin blocks fibrosis via Wnt2 signaling in human keloid fibroblasts.; Authors - Yumei Cai
human	WB	Medicine (Baltimore); Wnt2 knock down by RNAi inhibits the proliferation of in vitro-cultured human keloid fibroblasts.; Authors - Yumei Cai
		Biomed Res Int; Administration of Repetitive Transcranial Magnetic Stimulation Attenuates Aβ1-42-Induced Alzheimer's Disease in Mice by Activating β-Catenin Signaling.; Authors - Xueyun Chen