GSTA2 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86428-3-RR (same clone as 86428-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86428-3-RR (GSTA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86428-3-PBS in a different storage buffer formulation.

• 

  WB analysis of rat testis using 86428-3-RR (same clone as 86428-3-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 86428-3-RR (GSTA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86428-3-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02440-1

  The mean GSTA2 concentration was determined to be 5.91 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load and 58.64 ng/mL in HepG2 cell extract based on a 1.20 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02440-1

  Sandwich ELISA standard curve of MP02440-1, Human GSTA2 Recombinant Matched Antibody Pair - PBS only. 86428-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0781. 86428-2-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

• 

  Cytometric bead array sample test of MP02440-1

  The mean GSTA2 concentration was determined to be 135.2 ng/mL in HepG2 cell extract based on a 1.1 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02440-1

  Cytometric bead array standard curve of MP02440-1, GSTA2 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86428-3-PBS. Detection antibody: 86428-2-PBS. Standard: Ag0781. Range: 0.781-50 ng/mL.

• 

  Affinity and Kinetic Characterization of 86428-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86428-3-RR against Human GSTA2 were performed. The affinity constant is 0.158 nM.

GSTA2 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86428-3-PBS

Clone No.251223E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

EC:2.5.1.18, Glutathione S-transferase A2, GST class-alpha member 2, GST gamma, GST HA subunit 2

---

Product Information

86428-3-PBS targets GSTA2 as part of a matched antibody pair:

MP02440-1: 86428-3-PBS capture and 86428-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0781

  Product name: Recombinant human GSTA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-222 aa of BC002895

  Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

• Full Name: glutathione S-transferase alpha 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC002895
• Gene Symbol: GSTA2
• Gene ID (NCBI): 2939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09210
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. Glutathione S-transferase A2 (GSTA2) which is a phase II detoxifying enzyme is highly expressed in the liver tissue functioning in detoxification of electrophilic compounds, such as products of oxidative stress.