GSTA4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GSTA4 Polyclonal antibody (17271-1-AP)

• KD/KO Validated

GSTA4 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 17271-1-AP

Publications(11)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:2.5.1.18, Glutathione S transferase A4, Glutathione S transferase A4 4, Glutathione S-transferase A4, Glutathione S-transferase A4-4

• 

  WB analysis of human brain using 17271-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17271-1-AP (GSTA4 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293T using 17271-1-AP

  WB result of GSTA4 antibody (17271-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-GSTA4 transfected HEK-293T cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 17271-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17271-1-AP (GSTA4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of SH-SY5Y using 17271-1-AP

  IP result of anti-GSTA4 (IP:17271-1-AP, 4ug; Detection:17271-1-AP 1:500) with SH-SY5Y cells lysate 1600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 17271-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using GSTA4 antibody (17271-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human brain tissue, HEK-293T cells
• Positive IP detected in: SH-SY5Y cells
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17271-1-AP targets GSTA4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11028

  Product name: Recombinant human GSTA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-222 aa of BC015523

  Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

• Full Name: glutathione S-transferase alpha 4
• Calculated Molecular Weight: 222 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC015523
• Gene Symbol: GSTA4
• Gene ID (NCBI): 2941
• RRID: AB_2295133
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15217
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GSTA4 (Glutathione S-Transferase Alpha 4) is an enzyme that plays a key role in detoxification and antioxidant defense. Its structure includes a GSH-binding site and a hydrophobic substrate-binding domain, functioning as a dimer. Dysregulation of GSTA4 is linked to diseases like cancer, neurodegeneration, and diabetes.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis.; Authors - Dong Huang
human	WB	Free Radic Biol Med; Increased hepatocellular protein carbonylation in human end-stage alcoholic cirrhosis.; Authors - C T Shearn
mouse	WB	Mech Ageing Dev; WDR23 mediates NRF2 proteostasis and cytoprotective capacity in the hippocampus; Authors - Jiahui Liu
mouse	WB	J Lipid Res; Susceptibility of L-FABP-/- mice to oxidative stress in early-stage alcoholic liver.; Authors - Rebecca L Smathers
		PLoS One; Short term feeding of a high fat diet exerts an additive effect on hepatocellular damage and steatosis in liver-specific PTEN knockout mice.; Authors - Colin T Shearn
human	WB	Exp Mol Pathol; Dysregulation of antioxidant responses in patients diagnosed with concomitant Primary Sclerosing Cholangitis/Inflammatory Bowel Disease.; Authors - Colin T Shearn

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Iru (Verified Customer) (10-04-2021)

The antibody works well

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Fallopian tube epithelial cells