GSTK1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81527-1-RR (same clone as 81527-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81527-1-RR (GSTK1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81527-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 81527-1-RR (same clone as 81527-1-PBS)

  WB result of GSTK1 antibody (81527-1-RR; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GSTK1 transfected HepG2 cells. This data was developed using the same antibody clone with 81527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 81527-1-RR (same clone as 81527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 81527-1-RR (GSTK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 81527-1-RR (same clone as 81527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 81527-1-RR (GSTK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 81527-1-RR (same clone as 81527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 81527-1-RR (GSTK1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 81527-1-RR (same clone as 81527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 81527-1-RR (GSTK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 81527-1-RR (same clone as 81527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 81527-1-RR (GSTK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 81527-1-RR (same clone as 81527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 81527-1-RR (GSTK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81527-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 81527-1-RR (same clone as 81527-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using GSTK1 antibody (81527-1-RR, Clone: 3J1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81527-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 81527-1-RR (same clone as 81527-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GSTK1 antibody (81527-1-RR, Clone: 3J1 ) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 81527-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GSTK1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 81527-1-PBS

Clone No.3J1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

DsbA-L, EC:2.5.1.18, Glutathione S-transferase kappa 1, Glutathione S-transferase subunit 13, GST

---

Product Information

81527-1-PBS targets GSTK1 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6036

  Product name: Recombinant human GSTK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-226 aa of BC050715

  Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

• Full Name: glutathione S-transferase kappa 1
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC050715
• Gene Symbol: GSTK1
• Gene ID (NCBI): 373156
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y2Q3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GSTK1, glutathione S-transferase kappa 1, belongs to the superfamily of glutathione S-transferase (GST), which is related to oxidative stress (PMID:16081649). GSTK1 expression is negatively correlated with obesity and hypertrophic cardiomyopathy (PMID:21428694, PMID:27378925). GSTK1 was expressed in the peroxisomal and mitochondrial fractions and localized to peroxisomes (PubMed:14742434).