GSTO2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GSTO2 Polyclonal antibody (14562-1-AP)

GSTO2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14562-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, CoIP, ELISA

Synonyms

Monomethylarsonic acid reductase, GSTO-2, GSTO 2-2, Glutathione-dependent dehydroascorbate reductase, Glutathione S-transferase omega-2

• 

  WB analysis of mouse testis using 14562-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14562-1-AP (GSTO2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14562-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14562-1-AP (GSTO2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 14562-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14562-1-AP (GSTO2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 14562-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 14562-1-AP (GSTO2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 14562-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 14562-1-AP (GSTO2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GSTO2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HCT 116 cells, mouse testis tissue, rat testis tissue, mouse skeletal muscle tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14562-1-AP targets GSTO2 in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6120

  Product name: Recombinant human GSTO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-243 aa of BC056918

  Sequence: MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC

• Full Name: glutathione S-transferase omega 2
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-31 kDa
• GenBank Accession Number: BC056918
• Gene Symbol: GSTO2
• Gene ID (NCBI): 119391
• RRID: AB_2116205
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4Y5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GSTO2 Polyclonal antibody (Cat# 14562-1-AP) has 8 total citations published in journals including Cell Reports, Antioxidants (Basel), Aging, Bioorganic Chemistry, Journal of Gerontology A, Journal of Oncology, Age, and Disease Markers. Associated research fields include reproductive biology (male fecundity, sperm head morphology), neurodegeneration (Parkinson's disease), oxidative stress and aging, and oncology (colon cancer progression, gastric cancer methylation markers).

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Antioxidants (Basel); Decreased Klotho Expression Causes Accelerated Decline of Male Fecundity through Oxidative Injury in Murine Testis; Authors - Ya-Yun Wang
human	CoIP	Cell Rep; The perinuclear theca protein Calicin helps shape the sperm head and maintain the nuclear structure in mice.; Authors - Xiao-Zhen Zhang
rat	IF	Aging (Albany NY); Integrated transcriptome expression profiling reveals a novel lncRNA associated with L-DOPA-induced dyskinesia in a rat model of Parkinson's disease.; Authors - Chun-Lei Han
mouse	WB	Bioorg Chem; Two resveratrol analogs, pinosylvin and 4,4'-dihydroxystilbene, improve oligoasthenospermia in a mouse model by attenuating oxidative stress via the Nrf2-ARE pathway.; Authors - Cheng-Niu Wang
mouse	WB	J Gerontol A Biol Sci Med Sci; PMID: 24285747; Authors - Rojanathammanee Lalida L
human	WB	J Oncol; The Upregulation of GSTO2 is Associated with Colon Cancer Progression and a Poor Prognosis; Authors - Xingyu Peng