GSTP1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP02614-1

  Plasma of nine individual healthy human donors was measured. The GSTP1 concentration of detected samples was determined to be 32.7 ng/mL with a range of 10.5-115.3 ng/mL.

• 

  Sandwich ELISA standard curve of MP02614-1

  Sandwich ELISA standard curve of MP02614-1, Human GSTP1 Recombinant Matched Antibody Pair - PBS only. 86708-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag8731. 86708-2-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL.

• 

  Cytometric bead array sample test of MP02614-1

  The mean GSTP1 concentration was determined to be 40.6 ng/mL in Human plasma.

• 

  Cytometric bead array standard curve of MP02614-1

  Cytometric bead array standard curve of MP02614-1, GSTP1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86708-3-PBS. Detection antibody: 86708-2-PBS. Standard: Ag8731. Range: 0.156-20 ng/mL.

GSTP1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86708-2-PBS

Clone No.251705G6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

EC:2.5.1.18, FAEES3, Glutathione S-transferase P, GST3, GST3/GST pi

---

Product Information

86708-2-PBS targets GSTP1 as part of a matched antibody pair:

MP02614-1: 86708-3-PBS capture and 86708-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8731

  Product name: Recombinant human GSTP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of BC010915

  Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

• Full Name: glutathione S-transferase pi 1
• Calculated Molecular Weight: 210 aa, 23 kDa
• GenBank Accession Number: BC010915
• Gene Symbol: GSTP1
• Gene ID (NCBI): 2950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09211
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.