GSTT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GSTT2 Polyclonal antibody, PBS Only (15063-1-PBS)

• 

  WB analysis of rat liver using 15063-1-AP (same clone as 15063-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 15063-1-AP (GSTT2 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15063-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 15063-1-AP (same clone as 15063-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15063-1-AP (GSTT2 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15063-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 15063-1-AP (same clone as 15063-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 15063-1-AP (GSTT2 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15063-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 15063-1-AP (same clone as 15063-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 15063-1-AP (GSTT2 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 15063-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 15063-1-AP (same clone as 15063-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15063-1-AP (GSTT2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15063-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 15063-1-AP (same clone as 15063-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15063-1-AP (GSTT2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15063-1-PBS in a different storage buffer formulation.

• 

  IF Staining of L02 using 15063-1-AP (same clone as 15063-1-PBS)

  Immunofluorescent analysis of L02 cells using 15063-1-AP (GSTT2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15063-1-PBS in a different storage buffer formulation.

GSTT2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15063-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

15063-1-PBS targets GSTT2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7066

  Product name: Recombinant human GSTT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC002415

  Sequence: MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP

• Full Name: glutathione S-transferase theta 2
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC002415
• Gene Symbol: GSTT2
• Gene ID (NCBI): 2953
• RRID: AB_2878106
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0CG29
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.