GSTT2B Polyclonal antibody

• 

  WB analysis using 17622-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17622-1-AP (GSTT2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 17622-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 17622-1-AP (GSTT2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 17622-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17622-1-AP (GSTT2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 17622-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using GSTT2B antibody (17622-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

GSTT2B Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 17622-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

GSTT2, GST class-theta-2, GST class theta 2, Glutathione S-transferase theta-2B, Glutathione S-transferase theta-2

---

Tested Applications

• Positive WB detected in: mouse lung tissue, human liver tissue, human brain tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

17622-1-AP targets GSTT2B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11828

  Product name: Recombinant human GSTT2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC071700

  Sequence: MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP

• Full Name: glutathione S-transferase theta 2B (gene/pseudogene)
• Calculated Molecular Weight: 244 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC071700
• Gene Symbol: GSTT2B
• Gene ID (NCBI): 653689
• RRID: AB_2116359
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0CG30
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Gerontol A Biol Sci Med Sci; PMID: 24285747; Authors - Rojanathammanee Lalida L
mouse	WB	Age (Dordr); PMID: 25001375; Authors - Lalida Rojanathammanee
mouse	IHC	Sci Signal; Glutathione S-transferases promote proinflammatory astrocyte-microglia communication during brain inflammation.; Authors - Shin-Ichi Kano ; KD Validated