GSTZ1 Polyclonal antibody

GSTZ1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 14889-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

glutathione transferase zeta 1, GSTZ1, GSTZ1 1, MAAI, MAI, Maleylacetoacetate isomerase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, mouse liver tissue, rat liver tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14889-1-AP targets GSTZ1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6676

Product name: Recombinant human GSTZ1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-216 aa of BC001453

Sequence: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Predict reactive species
Full Name glutathione transferase zeta 1
Calculated Molecular Weight 24 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC001453
Gene Symbol GSTZ1
Gene ID (NCBI) 2954
RRIDAB_2116363
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43708
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutathione transferase zeta 1(GSTZ1) catalyzes the biotransformation of a range of α-haloacids, including dichloroacetic acid (DCA), and the penultimate step in the tyrosine degradation pathway. GSTZ1 is preferentially expressed in hepatocytes and renal proximal tubule cells where phenylalanine and tyrosine are catabolized(PMID: 16550164). This protein has 3 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IHC protocol for GSTZ1 antibody 14889-1-APDownload protocol
WB protocol for GSTZ1 antibody 14889-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Front Immunol

Identification and validation of a tyrosine metabolism-related prognostic prediction model and characterization of the tumor microenvironment infiltration in hepatocellular carcinoma

Authors - Yangying Zhou
mouseWB

J Gerontol A Biol Sci Med Sci

PMID: 24285747

Authors - Rojanathammanee Lalida L
mouseWB

Age (Dordr)

PMID: 25001375

Authors - Lalida Rojanathammanee
ratWB

BMC Complement Med Ther

Integrated proteomics and metabolomics analysis of lumbar in a rat model of osteoporosis treated with Gushukang capsules

Authors - Ruohui Lin
humanWB

ACS Chem Biol

Chemical Proteomics with Novel Fully Functionalized Fragments and Stringent Target Prioritization Identifies the Glutathione-Dependent Isomerase GSTZ1 as a Lung Cancer Target

Authors - Yi Liao
humanWB

Anal Chem

Spike-In Proteome Enhances Data-Independent Acquisition for Thermal Proteome Profiling

Authors - Qiqi Wang
Loading...
||
New chat Able
正在加载,请稍候...