GTF2H2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GTF2H2 Polyclonal antibody (16005-1-AP)

GTF2H2 Polyclonal Antibody for WB, ELISA

Cat No. 16005-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

BTF2, BTF2 p44, BTF2P44, T BTF2P44, TFIIH

• 

  WB analysis of K-562 using 16005-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16005-1-AP (GTF2H2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 16005-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16005-1-AP (GTF2H2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 16005-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16005-1-AP (GTF2H2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 16005-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16005-1-AP (GTF2H2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GTF2H2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16005-1-AP targets GTF2H2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8653

  Product name: Recombinant human GTF2H2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-165 aa of BC005345

  Sequence: MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKLVLYIMYN

• Full Name: general transcription factor IIH, polypeptide 2, 44kDa
• Calculated Molecular Weight: 395aa,44 kDa; 165aa,19 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC005345
• Gene Symbol: GTF2H2
• Gene ID (NCBI): 2966
• RRID: AB_2279415
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13888
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transcription factor IIH(TFIIH) is associated with the RNA polymerase II transcription complex, which is involved in transcription and transcription-mediated DNA repair. GTF2H2(GENERAL TRANSCRIPTION FACTOR IIH, POLYPEPTIDE 2) is one of the six subnuits forming the core-TFIIH basal transcriptional factor. TFIIH plays a role in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. The N terminus of GTF2H2 interacts with and regulates XPD, and an intact C terminus is required for a successful escape of RNAPol II from the promoter. This is a rabbit polyclonal antibody producted by part of N-terminal GTF2H2 of human origin.

Publications

What published studies show

The GTF2H2 Polyclonal antibody (Cat# 16005-1-AP) has 2 total citations. One appears in Tissue Cell (2022), studying exosome-derived GTF2H2's effects on endothelial cell viability and migration. The other is in Open Med (2026), characterizing immune infiltrates and molecular subtypes in allergic rhinitis. The associated research fields include exosome biology, endothelial cell function, and allergic disease immunology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Tissue Cell; Exosome-derived GTF2H2 from Huh7 cells can inhibit endothelial cell viability, migration, tube formation, and permeability; Authors - Zhenkun Li
		Open Med (Wars); Characterization of immune infiltrates, molecular subtypes and signature genes in patients with allergic rhinitis.; Authors - Wenfei Yang