Product Information
14539-1-AP targets GTF2H5 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6042 Product name: Recombinant human GTF2H5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-71 aa of BC060317 Sequence: MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK Predict reactive species |
| Full Name | general transcription factor IIH, polypeptide 5 |
| Calculated Molecular Weight | 8 kDa |
| GenBank Accession Number | BC060317 |
| Gene Symbol | GTF2H5 |
| Gene ID (NCBI) | 404672 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6ZYL4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The GTF2H5 Polyclonal antibody (Cat# 14539-1-AP) has 1 total citation. It appears in the Journal of Gynecologic Oncology, in a study investigating the NER-related gene GTF2H5 as a survival predictor in high-grade serous ovarian cancer patients. The associated research field is gynecologic oncology, specifically ovarian cancer prognosis and the nucleotide excision repair (NER) pathway. The antibody was applied via IHC on human samples.
| Species | Application | Title |
|---|---|---|
J Gynecol Oncol The NER-related gene GTF2H5 predicts survival in high-grade serous ovarian cancer patients. |
