GTF2H5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GTF2H5 Polyclonal antibody (29112-1-AP)

• 

  IHC staining of human ovary tumor using 29112-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29112-1-AP (GTF2H5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 29112-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 29112-1-AP (GTF2H5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 29112-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 29112-1-AP (GTF2H5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 29112-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 29112-1-AP (GTF2H5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GTF2H5 Polyclonal Antibody for IHC, ELISA

Cat No. 29112-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

bA120J8.2, C6orf175, TFB5, TFB5 ortholog, TFIIH basal transcription factor complex TTD-A subunit

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29112-1-AP targets GTF2H5 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30758

  Product name: Recombinant human GTF2H5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-42 aa of BC060317

  Sequence: MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTH

• Full Name: general transcription factor IIH, polypeptide 5
• Calculated Molecular Weight: 8 kDa
• GenBank Accession Number: BC060317
• Gene Symbol: GTF2H5
• Gene ID (NCBI): 404672
• RRID: AB_3742304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZYL4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GTF2H5 (General Transcription Factor IIH Subunit 5) is a protein encoded by the GTF2H5 gene in humans. It is also known by several other names, including TTDA, TFB5, and TFIIH subunit p8. This protein is a critical component of the TFIIH complex, which is involved in both gene transcription and DNA repair.