GTF3C2 Polyclonal antibody

• 

  WB analysis using 27494-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27494-1-AP (GTF3C2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 27494-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 27494-1-AP (GTF3C2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thyroid cancer using 27494-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 27494-1-AP (GTF3C2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 27494-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 27494-1-AP (GTF3C2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 27494-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 27494-1-AP (GTF3C2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 27494-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 27494-1-AP (GTF3C2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 27494-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 27494-1-AP (GTF3C2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 27494-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 27494-1-AP (GTF3C2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 27494-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 27494-1-AP (GTF3C2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 27494-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 27494-1-AP (GTF3C2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 27494-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GTF3C2 antibody (27494-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

GTF3C2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27494-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

TFIIIC110, TFIIIC BETA, TF3C-beta, TF3C beta, KIAA0011

---

Tested Applications

• Positive WB detected in: HEK-293T cells, A549 cells, HeLa cells, HepG2 cells, MCF-7 cells, PC-3 cells
• Positive IHC detected in: human thyroid cancer tissue, human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27494-1-AP targets GTF3C2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26666

  Product name: Recombinant human GTF3C2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 59-188 aa of BC020981

  Sequence: GFEDSPDQRRLPPEQESLSRLEQPDLSSEMSKVSKPRASKPGRKRGGRTRKGPKRPQQPNPPSAPLVPGLLDQSNPLSTPMPKKRGRKSKAELLLLKLSKDLDRPESQSPKRPPEDFETPSGERPRRRAA

• Full Name: general transcription factor IIIC, polypeptide 2, beta 110kDa
• Calculated Molecular Weight: 101 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC020981
• Gene Symbol: GTF3C2
• Gene ID (NCBI): 2976
• RRID: AB_2880889
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WUA4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GTF3C2, also named as KIAA0011, is a 911 amino acid protein, which localizes in the nucleus. GTF3C2 is required for RNA polymerase III-mediated transcription. GTF3C2 is a component of TFIIIC that initiates transcription complex assembly on tRNA and is required for transcription of 5S rRNA and other stable nuclear and cytoplasmic RNAs. GTF3C2 may play a direct role in stabilizing interactions of TFIIIC2 with TFIIIC1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Hum Genet; Biallelic variants in GTF3C5, a regulator of RNA polymerase III-mediated transcription, cause a multisystem developmental disorder; Authors - Aiko Iwata-Otsubo