GTF3C5 Polyclonal antibody

• 

  WB analysis of human lung using 11447-2-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11447-2-AP (GTF3C5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 11447-2-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11447-2-AP (GTF3C5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse lung using 11447-2-AP

  IP result of anti-GTF3C5 (IP:11447-2-AP, 4ug; Detection:11447-2-AP 1:300) with mouse lung tissue lysate 4000 ug.

GTF3C5 Polyclonal Antibody for WB, IP, ELISA

Cat No. 11447-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

GTF3C5, TF3C epsilon, TFIIIC 63 kDa subunit, TFiiiC2 63, TFIIIC63, TFIIICepsilon

---

Tested Applications

• Positive WB detected in: human lung tissue, mouse lung tissue
• Positive IP detected in: mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11447-2-AP targets GTF3C5 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1999

  Product name: Recombinant human GTF3C5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC017337

  Sequence: MAAEAADLGLGAAVPVELRRERRMVCVEYPGVVRDVAKMLPTLGGEEGVSRIYADPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKHTSMYDKVLMLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNAVKANISVHPDKLKVLLPFIAYYMITGPWRSLWIRFGYDPRKNPDAKIYQVLDFRIRCGMKHGYAPSDLPVKAKRSTYNYSLP

• Full Name: general transcription factor IIIC, polypeptide 5, 63kDa
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC017337
• Gene Symbol: GTF3C5
• Gene ID (NCBI): 9328
• RRID: AB_2115258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5Q8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.