GTL3 Polyclonal antibody

• 

  WB analysis using 19905-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19905-1-AP (GTL3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 19905-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 19905-1-AP (GTL3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 19905-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 19905-1-AP (GTL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GTL3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 19905-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

C16orf80, Basal body up-regulated protein 22, BUG22, CFAP20, Cilia- and flagella-associated protein 20

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19905-1-AP targets GTL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13881

  Product name: Recombinant human GTL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC005152

  Sequence: MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

• Full Name: chromosome 16 open reading frame 80
• Calculated Molecular Weight: 193 aa, 23 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC005152
• Gene Symbol: GTL3
• Gene ID (NCBI): 29105
• RRID: AB_3669317
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6A4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GTL3 (Cilia- and flagella-associated protein 20, also named CFAP20 ) may play a role in axonemal structure organization and motility.