GTPBP3 Polyclonal antibody

• 

  WB analysis of Jurkat using 10764-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10764-1-AP (GTPBP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 10764-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10764-1-AP (GTPBP3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 10764-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10764-1-AP (GTPBP3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse breast cancer using 10764-1-AP

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse breast cancer using GTPBP3 antibody (10764-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of U2OS using 10764-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using GTPBP3 antibody (10764-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

GTPBP3 Polyclonal Antibody for WB, IHC, IF/ICC, IF-Fro, ELISA

Cat No. 10764-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IF-Fro, ELISA

Synonyms

MTGP1, MSS1, Mitochondrial GTP-binding protein 1, GTP-binding protein 3, GTPBG3

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-Fro detected in: mouse breast cancer
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

10764-1-AP targets GTPBP3 in WB, IHC, IF/ICC, IF-Fro, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1198

  Product name: Recombinant human GTPBP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 111-492 aa of BC019261

  Sequence: VEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNLTEVEGLADLIHAETEAQRRQALRQLDGELGHLCRGWAETLTKALAHVEAYIDFGEDDNLEEGVLEQADIEVRALQVALGAHLRDARRGQRLRSGVHVVVTGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLAGFPVLLSDTAGLREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVASVGAQSPSDSSQHLLLVLNKSDLLSPEGPGPGPDLPPHLLLSCLTGEGLDGLLEALRKELAAVCGDPSTDPPLLTRARHQHHLQGCLDALGHYKQSKDLALAAEALRVARGHLTRLTGGGGTEEILDIIFQDFCVGK

• Full Name: GTP binding protein 3 (mitochondrial)
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC019261
• Gene Symbol: GTPBP3
• Gene ID (NCBI): 84705
• RRID: AB_2115389
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969Y2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Struct Mol Biol; TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS.; Authors - Xinxin Zuo
human	WB	Cell Discov; m6Am methyltransferase PCIF1 is essential for aggressiveness of gastric cancer cells by inhibiting TM9SF1 mRNA translation.; Authors - Wei Zhuo
human	WB	Mol Biol Rep; Spheroid architecture strongly enhances miR-221/222 expression and promotes oxidative phosphorylation in an ovarian cancer cell line through a mechanism that includes restriction of miR-9 expression; Authors - Avery S Ward