GTPBP5 Polyclonal antibody

• 

  WB analysis using 20133-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 20133-1-AP (GTPBP5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 20133-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 20133-1-AP (GTPBP5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 20133-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 20133-1-AP (GTPBP5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 20133-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20133-1-AP (GTPBP5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of LNCaP using 20133-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 20133-1-AP (GTPBP5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 20133-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20133-1-AP (GTPBP5 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 20133-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20133-1-AP (GTPBP5 antibody) at dilution of 1:100 (under 40x lens).

GTPBP5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20133-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GTP binding protein 5, GTPBP5, ObgH1, Protein obg homolog 1

---

Tested Applications

• Positive WB detected in: U2OS cells, Jurkat cells, HEK-293 cells, LNCaP cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

20133-1-AP targets GTPBP5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14015

  Product name: Recombinant human GTPBP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 57-406 aa of BC036716

  Sequence: LPGKKLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLPEAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW

• Full Name: GTP binding protein 5 (putative)
• Calculated Molecular Weight: 406 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC036716
• Gene Symbol: GTPBP5
• Gene ID (NCBI): 26164
• RRID: AB_10666316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4K7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Mol Life Sci; GTPBP8 is required for mitoribosomal biogenesis and mitochondrial translation; Authors - Liang Wang
human	WB	PLoS Genet; RCC1L (WBSCR16) isoforms coordinate mitochondrial ribosome assembly through their interaction with GTPases.; Authors - Aurelio Reyes