GTPBP5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GTPBP5 Polyclonal antibody (20133-1-AP)

GTPBP5 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 20133-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

GTP-binding protein 5, Mitochondrial ribosome-associated GTPase 2, MTG2, ObgH1, Protein obg homolog 1

• 

  WB analysis using 20133-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 20133-1-AP (GTPBP5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 20133-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 20133-1-AP (GTPBP5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 20133-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 20133-1-AP (GTPBP5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 20133-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20133-1-AP (GTPBP5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of LNCaP using 20133-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 20133-1-AP (GTPBP5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 20133-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20133-1-AP (GTPBP5 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 20133-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20133-1-AP (GTPBP5 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 20133-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using GTPBP5 antibody (20133-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GTPBP5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U2OS cells, Jurkat cells, HEK-293 cells, LNCaP cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20133-1-AP targets GTPBP5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14015

  Product name: Recombinant human GTPBP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 57-406 aa of BC036716

  Sequence: LPGKKLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLPEAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW

• Full Name: GTP binding protein 5 (putative)
• Calculated Molecular Weight: 406 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC036716
• Gene Symbol: GTPBP5
• Gene ID (NCBI): 26164
• RRID: AB_10666316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4K7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GTPBP5 Polyclonal antibody (Cat# 20133-1-AP) has 3 citations published in Cell Mol Life Sci, Invest Ophthalmol Vis Sci, and PLoS Genet. The associated research fields include mitochondrial ribosome biogenesis and translation, mitochondrial DNA dynamics in uveal melanoma, and coordination of mitochondrial ribosome assembly through GTPase interactions. All citations report use of the antibody in Western blot applications with human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Mol Life Sci; GTPBP8 is required for mitoribosomal biogenesis and mitochondrial translation; Authors - Liang Wang
human	WB	Invest Ophthalmol Vis Sci; MTG2 as a Causal and Druggable Target in Uveal Melanoma via Mitochondrial DNA Dynamics: Evidence From Functional Validation and DMSA Identification.; Authors - Yan Zhang ; KD Validated
human	WB	PLoS Genet; RCC1L (WBSCR16) isoforms coordinate mitochondrial ribosome assembly through their interaction with GTPases.; Authors - Aurelio Reyes