GUCY1A3 Polyclonal antibody

• 

  WB analysis of human brain using 12605-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human cerebellum using 12605-1-AP

  human cerebellum tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 12605-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 12605-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 12605-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 12605-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse lung using 12605-1-AP

  IP result of anti-GUCY1A3 (IP:12605-1-AP, 4ug; Detection:12605-1-AP 1:500) with mouse lung tissue lysate 3600ug.

• 

  IHC staining of human heart using 12605-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12605-1-AP (GUCY1A3 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 12605-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12605-1-AP (GUCY1A3 Antibody) at dilution of 1:50 (under 40x lens).

GUCY1A3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12605-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EC:4.6.1.2, GC SA3, GCS alpha 1, GCS alpha 3, GCS-alpha-1

---

Tested Applications

• Positive WB detected in: human brain tissue, human cerebellum tissue, human kidney tissue, mouse lung tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below
• IHC: See 1 publications below
• IF: See 3 publications below

Product Information

12605-1-AP targets GUCY1A3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3293

  Product name: Recombinant human GUCY1A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 391-690 aa of BC028384

  Sequence: EDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMAVKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID

• Full Name: guanylate cyclase 1, soluble, alpha 3
• Calculated Molecular Weight: 690 aa, 77 kDa
• Observed Molecular Weight: 77 kDa
• GenBank Accession Number: BC028384
• Gene Symbol: GUCY1A3
• Gene ID (NCBI): 2982
• RRID: AB_2248099
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02108
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Guanylate cyclase soluble subunit alpha-1 (GUCY1A3, also known as GUCY1A1, GCS-alpha-1, and GCS-alpha-3) is a lyase that plays a role in cGMP biosynthesis (PMID: 24155296). GUCY1A3 activation may be considered as a strategy to alleviate endothelial ferroptosis and cardiac microvascular reperfusion injury (PMID: 40856046). GUCY1A3 is also known to be associated with coronary artery disease and pulmonary artery hypertension (PMID: 24213632; 25373139).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Hepatology; Single-cell transcriptomic analysis reveals a hepatic stellate cell-activation roadmap and myofibroblast origin during liver fibrosis.; Authors - Wu Yang
mouse	WB	Nat Commun; Aortic disease in Marfan syndrome is caused by overactivation of sGC-PRKG signaling by NO.; Authors - Andrea de la Fuente-Alonso
mouse	WB	Int J Mol Sci; Hypertensive Effect of Downregulation of the Opioid System in Mouse Model of Different Activity of the Endogenous Opioid System.; Authors - Dominik S Skiba
mouse	WB	J Ethnopharmacol; Modified Zhenwu Decoction improved intestinal barrier function of experimental colitis through activation of sGC-mediated cGMP/PKG signaling; Authors - Yiqi Xu
mouse	WB,IHC	Sci Rep; Hypertension reduces soluble guanylyl cyclase expression in the mouse aorta via the Notch signaling pathway.; Authors - Catarina Rippe
		Eur J Pharmacol; Sodium valproate treatment reverses endothelial dysfunction in aorta from rabbits with acute myocardial infarction; Authors - Sol Guerra-Ojeda