GUCY1A3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GUCY1A3 Polyclonal antibody (12605-1-AP)

GUCY1A3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12605-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EC:4.6.1.2, GC SA3, GCS alpha 1, GCS alpha 3, GCS-alpha-1

• 

  WB analysis of human brain using 12605-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 12605-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human cerebellum using 12605-1-AP

  human cerebellum tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 12605-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 12605-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 12605-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12605-1-AP (GUCY1A3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse lung using 12605-1-AP

  IP result of anti-GUCY1A3 (IP:12605-1-AP, 4ug; Detection:12605-1-AP 1:500) with mouse lung tissue lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 12605-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 12605-1-AP (GUCY1A3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 12605-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 12605-1-AP (GUCY1A3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 12605-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12605-1-AP (GUCY1A3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 12605-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12605-1-AP (GUCY1A3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GUCY1A3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue, human cerebellum tissue, human kidney tissue, mouse lung tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: mouse heart tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12605-1-AP targets GUCY1A3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3293

  Product name: Recombinant human GUCY1A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 391-690 aa of BC028384

  Sequence: EDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMAVKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID

• Full Name: guanylate cyclase 1, soluble, alpha 3
• Calculated Molecular Weight: 690 aa, 77 kDa
• Observed Molecular Weight: 77 kDa
• GenBank Accession Number: BC028384
• Gene Symbol: GUCY1A3
• Gene ID (NCBI): 2982
• RRID: AB_2248099
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02108
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Guanylate cyclase soluble subunit alpha-1 (GUCY1A3, also known as GUCY1A1, GCS-alpha-1, and GCS-alpha-3) is a lyase that plays a role in cGMP biosynthesis (PMID: 24155296). GUCY1A3 activation may be considered as a strategy to alleviate endothelial ferroptosis and cardiac microvascular reperfusion injury (PMID: 40856046). GUCY1A3 is also known to be associated with coronary artery disease and pulmonary artery hypertension (PMID: 24213632; 25373139).

Publications

What published studies show

The GUCY1A3 Polyclonal antibody (Cat# 12605-1-AP) has 12 citations published in journals including Nature Communications, Hepatology, Advanced Science, Journal of Experimental Medicine, Journal of Ethnopharmacology, Frontiers in Endocrinology, European Journal of Pharmacology, International Immunopharmacology, International Journal of Molecular Sciences, Frontiers in Pharmacology, Scientific Reports, and bioRxiv. Research fields span cardiovascular disease, liver fibrosis, colitis, preeclampsia, skeletal muscle atrophy, and NO/cGMP/PKG signaling.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Aortic disease in Marfan syndrome is caused by overactivation of sGC-PRKG signaling by NO.; Authors - Andrea de la Fuente-Alonso
mouse	IF	Hepatology; Single-cell transcriptomic analysis reveals a hepatic stellate cell-activation roadmap and myofibroblast origin during liver fibrosis.; Authors - Wu Yang
mouse	WB,IF	Adv Sci (Weinh); Bifidobacterium pseudolongum-Derived Bile Acid from Dietary Carvacrol and Thymol Supplementation Attenuates Colitis via cGMP-PKG-mTORC1 Pathway; Authors - Ke Zhang
	WB,IF	J Exp Med; Activating NO-sGC crosstalk in the mouse vascular niche promotes vascular integrity and mitigates acute lung injury; Authors - Hao He
mouse	WB	J Ethnopharmacol; Modified Zhenwu Decoction improved intestinal barrier function of experimental colitis through activation of sGC-mediated cGMP/PKG signaling; Authors - Yiqi Xu
human	WB	Front Endocrinol (Lausanne); Specific dilation pattern in placental circulation and the NO/sGC role in preeclampsia placental vessels; Authors - Jiaqi Tang