GYG1 Polyclonal antibody

• 

  WB analysis using 12836-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12836-1-AP (GYG1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 12836-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 12836-1-AP (GYG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thyroid cancer using 12836-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 12836-1-AP (GYG1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 12836-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 12836-1-AP (GYG1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 12836-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 12836-1-AP (GYG1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skeletal muscle using 12836-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 12836-1-AP (GYG1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GYG1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12836-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:2.4.1.186, glycogenin 1, Glycogenin-1, GN1, GN-1

---

Tested Applications

• Positive WB detected in: MCF-7 cells, human testis tissue, U-251 cells
• Positive IHC detected in: human thyroid cancer tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12836-1-AP targets GYG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3583

  Product name: Recombinant human GYG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-331 aa of BC031096

  Sequence: DQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

• Full Name: glycogenin 1
• Calculated Molecular Weight: 350 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC031096
• Gene Symbol: GYG1
• Gene ID (NCBI): 2992
• RRID: AB_2116101
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46976
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The GYG1 gene encodes glycogenin-1, a core protein in muscle glycogen particles. GYG1 is a glycosyltransferase that forms a short glucose polymer of approximately 10 glucose residues by autoglucosylation (PMID: 25272951 ). Cardiomyopathy and muscle weakness associated with muscle glycogen depletion can also be caused by impaired priming of glycogen synthesis due to inactivation of muscle glycogenin (glycogenin-1) (PMID: 20357282).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Carbohydr Polym; Liver fibrosis alters the molecular structures of hepatic glycogen; Authors - Yujun Wan